Ephrin B3, Mouse (HEK293, His)

Name: Ephrin B3, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0203476-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0203476-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Ephrin B3 protein, a transmembrane ligand, binds adjacent Eph receptors, triggering bidirectional signaling. It induces axon collapse in vitro and may influence axon guidance and orientation. Ephrin B3 interacts with GRIP1 and GRIP2, suggesting regulatory roles in development and cellular functions. Ephrin B3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin B3 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
13643 (Gene_ID) O35393 (L28-A227) (Accession)
Smiles
LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPPPSMPA
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0203476-01	2 µgQM-0203476-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0203476-02	10 µgQM-0203476-02 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

50 µgQM-0203476-03	50 µgQM-0203476-03 £232.25/ea	£0.00	Quantity	£232.25/ea	£0.00

100 µgQM-0203476-04	100 µgQM-0203476-04 £359.82/ea	£0.00	Quantity	£359.82/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Ephrin B3, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.