Skip to product information
1 of 1

Ephrin B3, Rat (HEK293, His)

Ephrin B3, Rat (HEK293, His)

Size

SKU:QM-0203127-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Ephrin B3 Protein, a member of the ephrin family, lacks conserved residue (s) crucial for feature annotation propagation. This unique molecular profile suggests distinct functional properties and interactions within the ephrin family. Investigating the specific role and implications of this divergence in conserved residues is crucial to understand Ephrin B3's functional nuances and cellular significance in biological processes. Ephrin B3 Protein, Rat (HEK293, His) is the recombinant rat-derived Ephrin B3 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    360546 (Gene_ID) G3V7D4 (L28-S224) (Accession)

  • Smiles

    MGGPHFGPGGVQVGALLLLGFAGLVSGLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSQEPGKDSIPGDPNSNATSRGAEGPLPPPS

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0203127-01
2 µgQM-0203127-01
£52.94/ea
£0.00
£52.94/ea £0.00
10 µgQM-0203127-02
10 µgQM-0203127-02
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0203127-03
50 µgQM-0203127-03
£243.19/ea
£0.00
£243.19/ea £0.00
100 µgQM-0203127-04
100 µgQM-0203127-04
£359.82/ea
£0.00
£359.82/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Ephrin B3, Rat (HEK293, His)

Ephrin B3, Rat (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.