Name: Epigen, Human (E. coli)
Brand: QuantiMol
SKU: QM-0205674-01
Price: 67.44 GBP
Availability: InStock

Product Details

Description
Epigen Protein, Human (E. coli) is the recombinant human-derived Epigen, expressed by E. coli , with tag Free labeled tag.
Molecular Formula
255324 (Gene_ID) Q6UW88-1 (A24-A104) (Accession)
Smiles
AVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0205674-01	2 µgQM-0205674-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0205674-02	10 µgQM-0205674-02 £188.51/ea	£0.00	Quantity	£188.51/ea	£0.00

50 µgQM-0205674-03	50 µgQM-0205674-03 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

100 µgQM-0205674-04	100 µgQM-0205674-04 £669.65/ea	£0.00	Quantity	£669.65/ea	£0.00

500 µgQM-0205674-05	500 µgQM-0205674-05 £1,599.13/ea	£0.00	Quantity	£1,599.13/ea	£0.00

1 mgQM-0205674-06	1 mgQM-0205674-06 £2,207.84/ea	£0.00	Quantity	£2,207.84/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Epigen, Human (E. coli)

Epigen, Human (E. coli) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.