Epiregulin, Human

Name: Epiregulin, Human
Brand: QuantiMol
SKU: QM-0204874-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0204874-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Epiregulin Protein, Human is a growth regulator and a member of the epidermal growth factor (EGF) family. Epiregulin is a tumor growth-inhibitory factor inducing morphological changes in human epidermoid carcinoma HeLa cells.
Molecular Formula
2069 (Gene_ID) O14944 (V60-L108) (Accession)
Smiles
VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0204874-01	2 µgQM-0204874-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0204874-02	10 µgQM-0204874-02 £122.88/ea	£0.00	Quantity	£122.88/ea	£0.00

50 µgQM-0204874-03	50 µgQM-0204874-03 £342.81/ea	£0.00	Quantity	£342.81/ea	£0.00

100 µgQM-0204874-04	100 µgQM-0204874-04 £548.15/ea	£0.00	Quantity	£548.15/ea	£0.00

500 µgQM-0204874-05	500 µgQM-0204874-05 £1,377.99/ea	£0.00	Quantity	£1,377.99/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Epiregulin, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.