Skip to product information
1 of 1

Epiregulin, Human (HEK293, Fc)

Epiregulin, Human (HEK293, Fc)

Size

SKU:QM-0206022-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Epiregulin Protein, a ligand for EGFR and ERBB4, crucially influences inflammation, wound healing, tissue repair, and oocyte maturation. It stimulates tyrosine phosphorylation of both receptors, regulating angiogenesis, vascular remodeling, and cell proliferation. Interactions with EGFR and ERBB4 contribute to intricate signaling pathways, essential for diverse physiological responses and cellular functions. Epiregulin Protein, Human (HEK293, Fc) is the recombinant human-derived Epiregulin protein, expressed by HEK293 , with N-hFc labeled tag.

  • Molecular Formula

    2069 (Gene_ID) O14944/NP_001423.1 (V63-L108) (Accession)

  • Smiles

    VSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL

  • Purity

    96.2

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0206022-01
2 µgQM-0206022-01
£52.94/ea
£0.00
£52.94/ea £0.00
5 µgQM-0206022-02
5 µgQM-0206022-02
£76.75/ea
£0.00
£76.75/ea £0.00
10 µgQM-0206022-03
10 µgQM-0206022-03
£110.50/ea
£0.00
£110.50/ea £0.00
20 µgQM-0206022-04
20 µgQM-0206022-04
£188.51/ea
£0.00
£188.51/ea £0.00
50 µgQM-0206022-05
50 µgQM-0206022-05
£307.58/ea
£0.00
£307.58/ea £0.00
100 µgQM-0206022-06
100 µgQM-0206022-06
£437.58/ea
£0.00
£437.58/ea £0.00
500 µgQM-0206022-07
500 µgQM-0206022-07
£1,267.43/ea
£0.00
£1,267.43/ea £0.00
1 mgQM-0206022-08
1 mgQM-0206022-08
£2,120.36/ea
£0.00
£2,120.36/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Epiregulin, Human (HEK293, Fc)

Epiregulin, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.