Skip to product information
1 of 1

ER alpha/ESR1, Human (His)

ER alpha/ESR1, Human (His)

Size

SKU:QM-0203032-01

£101.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

  • Smiles

    MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203032-01
5 µgQM-0203032-01
£101.50/ea
£0.00
£101.50/ea £0.00
10 µgQM-0203032-02
10 µgQM-0203032-02
£147.63/ea
£0.00
£147.63/ea £0.00
50 µgQM-0203032-03
50 µgQM-0203032-03
£437.58/ea
£0.00
£437.58/ea £0.00
100 µgQM-0203032-04
100 µgQM-0203032-04
£714.61/ea
£0.00
£714.61/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

ER alpha/ESR1, Human (His)

ER alpha/ESR1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.