Skip to product information
1 of 1

Erythropoietin/EPO, Human (CHO)

Erythropoietin/EPO, Human (CHO)

Size

SKU:QM-0202630-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Erythropoietin/EPO is a renal cytokine that activates Akt and NF-κB signaling pathways by binding to erythroid progenitor cells EPOR. Erythropoietin/EPO regulates erythroid proliferation and differentiation and inhibits apoptosis. Erythropoietin/EPO also has angiogenic ability comparable to VEGF and can stimulate endothelial cell capillary sprouting. Erythropoietin/EPO can be used in the study of ischemic heart diseases such as anemia in end-stage renal disease. Erythropoietin/EPO Protein, Human (CHO) is a recombinant Erythropoietin/EPO protein expressed in CHO cells with tag-free.

  • Molecular Formula

    2056 (Gene_ID) P01588 (A28-R193) (Accession)

  • Smiles

    APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0202630-01
2 µgQM-0202630-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0202630-02
10 µgQM-0202630-02
£107.13/ea
£0.00
£107.13/ea £0.00
50 µgQM-0202630-03
50 µgQM-0202630-03
£260.19/ea
£0.00
£260.19/ea £0.00
100 µgQM-0202630-04
100 µgQM-0202630-04
£404.78/ea
£0.00
£404.78/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Erythropoietin/EPO, Human (CHO)

Erythropoietin/EPO, Human (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.