Skip to product information
1 of 1

Erythropoietin/EPO, Pig (His-B2M)

Erythropoietin/EPO, Pig (His-B2M)

Size

SKU:QM-0085075

Price on request
Quantity

Request quote or documents

View full details
  • Description

    Erythropoietin (EPO) protein regulates erythrocyte proliferation and differentiation. EPO binds to its receptor (EPOR), inducing EPOR dimerization and activating JAK2. This triggers downstream effectors like STAT1 and STAT3, maintaining erythrocyte mass and homeostasis. Erythropoietin/EPO Protein, Pig (His-B2M) is the recombinant pig-derived Erythropoietin/EPO protein, expressed by E. coli , with N-6*His, B2M labeled tag.

  • Molecular Formula

    397249 (Gene_ID) P49157 (A27-R194) (Accession)

  • Smiles

    APPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGKLTLYTGEACRRRDR

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0085075
1 EachQM-0085075
£0.00/ea
£0.00
£0.00/ea £0.00

Erythropoietin/EPO, Pig (His-B2M)

Erythropoietin/EPO, Pig (His-B2M) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.