1 1

Erythropoietin receptor/EpoR, Human (HEK293, His)

Erythropoietin receptor/EpoR, Human (HEK293, His)

Size

QM-0202437-01

£58.12 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    The EPOR Protein functions as a receptor for erythropoietin, mediating erythroblast proliferation and differentiation upon EPO stimulation. The heterodimer triggers the JAK2/STAT5 signaling cascade and, in certain cell types, activates STAT1, STAT3, and the LYN tyrosine kinase. Additionally, isoform EPOR-T acts as a dominant-negative receptor, modulating EPOR-mediated signaling pathways. Erythropoietin receptor/EpoR Protein, Human (HEK293, His) is the recombinant human-derived Erythropoietin receptor/EpoR protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    2057 (Gene_ID) P19235-1 (A25-P250) (Accession)

  • Smiles

    APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0202437-01
2 µgQM-0202437-01
£58.12/ea		 £0.00
£58.12/ea £0.00
10 µgQM-0202437-02
10 µgQM-0202437-02
£122.88/ea		 £0.00
£122.88/ea £0.00
50 µgQM-0202437-03
50 µgQM-0202437-03
£316.08/ea		 £0.00
£316.08/ea £0.00
100 µgQM-0202437-04
100 µgQM-0202437-04
£492.26/ea		 £0.00
£492.26/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Erythropoietin receptor/EpoR, Human (HEK293, His)

Erythropoietin receptor/EpoR, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.