Skip to product information
1 of 1

FABP2/I-FABP, Human (His)

FABP2/I-FABP, Human (His)

Size

SKU:QM-0172383-01

£107.13 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    FABP2, also known as I-FABP, is involved in the intracellular transport of long-chain fatty acids and their acyl-CoA esters, reflecting its potential role in various metabolic processes. In particular, FABP2 is thought to be involved in triglyceride-rich lipoprotein synthesis, suggesting its importance in lipid metabolism. FABP2/I-FABP Protein, Human (His) is the recombinant human-derived FABP2/I-FABP protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

  • Molecular Formula

    2169 (Gene_ID) P12104 (M1-D132) (Accession)

  • Smiles

    MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0172383-01
10 µgQM-0172383-01
£107.13/ea
£0.00
£107.13/ea £0.00
50 µgQM-0172383-02
50 µgQM-0172383-02
£293.00/ea
£0.00
£293.00/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FABP2/I-FABP, Human (His)

FABP2/I-FABP, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.