FABP3, Human (His)

Name: FABP3, Human (His)
Brand: QuantiMol
SKU: QM-0192910-01
Price: 143.13 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0192910-01

£143.13 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
FABP3 Protein, Human (His) is a recombinant FABP3 protein with a His-flag. FABP3 Protein is expressed in the skeletal muscle, heart, brain and brown adipose tissue[1].
Molecular Formula
2170 (Gene_ID) P05413 (V2-A133) (Accession)
Smiles
VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0192910-01	10 µgQM-0192910-01 £143.13/ea	£0.00	Quantity	£143.13/ea	£0.00

50 µgQM-0192910-02	50 µgQM-0192910-02 £404.78/ea	£0.00	Quantity	£404.78/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

FABP3, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.