Skip to product information
1 of 1

FAM3B, Human (HEK293, Fc)

FAM3B, Human (HEK293, Fc)

Size

SKU:QM-0170562-01

£91.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    FAM3B Protein acts as a potent inducer of apoptosis, influencing alpha and beta cells in a dose- and time-dependent manner. Its regulatory impact on programmed cell death underscores its significance, particularly within apoptosis. The specificity for alpha and beta cells suggests targeted modulation of pancreatic cell populations, implicating FAM3B in key processes related to pancreatic function and homeostasis. FAM3B Protein, Human (HEK293, Fc) is the recombinant human-derived FAM3B protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    54097 (Gene_ID) P58499-1 (E30-S235) (Accession)

  • Smiles

    ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0170562-01
10 µgQM-0170562-01
£91.38/ea
£0.00
£91.38/ea £0.00
50 µgQM-0170562-02
50 µgQM-0170562-02
£255.34/ea
£0.00
£255.34/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FAM3B, Human (HEK293, Fc)

FAM3B, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.