1 1

FBXO22, Human (His)

FBXO22, Human (His)

Size

QM-0027839

Price on request

Request quote or documents

View full details

Product Details

  • Description

    FBXO22 Protein, Human (His) is the recombinant human-derived FBXO22, expressed by E. coli , with C-6*His labeled tag.

  • Molecular Formula

    26263 (Gene_ID) Q8NEZ5 (M1-K403) (Accession)

  • Smiles

    MEPVGCCGECRGSSVDPRSTFVLSNLAEVVERVLTFLPAKALLRVACVCRLWRECVRRVLRTHRSVTWISAGLAEAGHLEGHCLVRVVAEELENVRILPHTVLYMADSETFISLEECRGHKRARKRTSMETALALEKLFPKQCQVLGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLFPQIEGIKIQPFHFIKDPKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKNPLDIDASGVVGLSFSGHRIQSATVLLNEDVSDEKTAEAAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFGNGEIGCDRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
1 EachQM-0027839
1 EachQM-0027839
£0.00/ea		 £0.00
£0.00/ea £0.00

Related Products

Other industry favorites

FBXO22, Human (His)

FBXO22, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.