Skip to product information
1 of 1

FBXO48, Human (His, Myc)

FBXO48, Human (His, Myc)

Size

SKU:QM-0128957-01

£342.81 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The FBXO48 Protein is part of the SCF ubiquitin ligase complex and participates in the catabolism of SCF-dependent proteasome ubiquitin-dependent proteins. The FBXO48 Protein undergoes polyubiquitination and proteasome degradation by targeting activity-phosphorylated Ampk (PAMPK-) . FBXO48 Protein, Human (His) is the recombinant human-derived FBXO48 protein, expressed by E. coli , with N-His, C-Myc labeled tag.

  • Molecular Formula

    554251 (Gene_ID) Q5FWF7 (M1-R155) (Accession)

  • Smiles

    MHKNSKRNNNLRVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASLTCRSWNDTIRNSDSLWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLSGRYSNICSPISLPEKIMYPMDADTWGEILEAELER

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0128957-01
20 µgQM-0128957-01
£342.81/ea
£0.00
£342.81/ea £0.00
50 µgQM-0128957-02
50 µgQM-0128957-02
£591.89/ea
£0.00
£591.89/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FBXO48, Human (His, Myc)

FBXO48, Human (His, Myc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.