Fc epsilon RIA/FCER1A, Human (His-SUMO)

The Fc epsilon RIA/FCER1A protein is a high-affinity receptor for IgE and critically mediates IgE effector function in myeloid cells. After binding to IgE and cross-linking with antigen, it activates signaling pathways that induce myeloid cell activation and differentiation. Fc epsilon RIA/FCER1A Protein, Human (His-SUMO) is the recombinant human-derived Fc epsilon RIA/FCER1A protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

2205 (Gene_ID) P12319 (V26-Q205) (Accession)

VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ

90

Stored at -20°C for 2 years

Room temperature in continental US; may vary elsewhere.