Fc gamma RIIA/CD32a, Human (HEK293, His)

Name: Fc gamma RIIA/CD32a, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0202490-01
Price: 76.75 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202490-01

£76.75 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Fc gamma The RIIA/CD32a protein plays a key role as a low-affinity receptor that specifically binds to the Fc region of immunoglobulin gamma. It interacts with IgG to initiate cellular responses against pathogens, which is critical for immune regulation. Fc gamma RIIA/CD32a Protein, Human (HEK293, His) is the recombinant human-derived Fc gamma RIIA/CD32a protein, expressed by HEK293 , with C-6*His labeled tag and H167, , , , mutation.
Molecular Formula
2212 (Gene_ID) P12318-1 (A36-I218, H167) (Accession)
Smiles
AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202490-01	5 µgQM-0202490-01 £76.75/ea	£0.00	Quantity	£76.75/ea	£0.00

10 µgQM-0202490-02	10 µgQM-0202490-02 £120.63/ea	£0.00	Quantity	£120.63/ea	£0.00

50 µgQM-0202490-03	50 µgQM-0202490-03 £337.95/ea	£0.00	Quantity	£337.95/ea	£0.00

100 µgQM-0202490-04	100 µgQM-0202490-04 £537.21/ea	£0.00	Quantity	£537.21/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Fc gamma RIIA/CD32a, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.