Skip to product information
1 of 1

Fc gamma RIIIA/CD16a, Cynomolgus (HEK293, His)

Fc gamma RIIIA/CD16a, Cynomolgus (HEK293, His)

Size

SKU:QM-0095751

Price on request
Quantity

Request quote or documents

View full details
  • Description

    FCGR3A is a receptor for the Fc portion of immunoglobulin G that enhances antibody-dependent cell-mediated cytotoxicity and antibody-dependent viral infection. FCGR3A is also a potential immune oncogenic molecule and is related to the level of tumor immune infiltration. FCGR3A is often used as a biomarker with prognostic value in prostate cancer (PCa) . Fc gamma RIIIA/CD16a Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Fc gamma RIIIA/CD16a protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    102140945 (Gene_ID) A0A140HDP8 (E21-G206) (Accession)

  • Smiles

    EDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTRWFHNESLISSQTSSYFIAAARVNNSGEYRCQTSLSTLSDPVQLEVHIGWLLLQAPRWVFKEEESIHLRCHSWKNTLLHKVTYLQNGKGRKYFHQNSDFYIPKATLKDSGSYFCRGLIGSKNVSSETVNITITQDLAVSSISSFFPPG

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0095751
1 EachQM-0095751
£0.00/ea
£0.00
£0.00/ea £0.00

Fc gamma RIIIA/CD16a, Cynomolgus (HEK293, His)

Fc gamma RIIIA/CD16a, Cynomolgus (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.