Fc gamma RIIIA/CD16a, Cynomolgus (HEK293, His)
Fc gamma RIIIA/CD16a, Cynomolgus (HEK293, His)
SKU:QM-0095751
Request quote or documents

Product Details
-
Description
FCGR3A is a receptor for the Fc portion of immunoglobulin G that enhances antibody-dependent cell-mediated cytotoxicity and antibody-dependent viral infection. FCGR3A is also a potential immune oncogenic molecule and is related to the level of tumor immune infiltration. FCGR3A is often used as a biomarker with prognostic value in prostate cancer (PCa) . Fc gamma RIIIA/CD16a Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Fc gamma RIIIA/CD16a protein, expressed by HEK293 , with C-6*His labeled tag.
-
Molecular Formula
102140945 (Gene_ID) A0A140HDP8 (E21-G206) (Accession)
-
Smiles
EDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTRWFHNESLISSQTSSYFIAAARVNNSGEYRCQTSLSTLSDPVQLEVHIGWLLLQAPRWVFKEEESIHLRCHSWKNTLLHKVTYLQNGKGRKYFHQNSDFYIPKATLKDSGSYFCRGLIGSKNVSSETVNITITQDLAVSSISSFFPPG
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
Fc gamma RIIIA/CD16a, Cynomolgus (HEK293, His)
Fc gamma RIIIA/CD16a, Cynomolgus (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.