Skip to product information
1 of 1

Fc gamma RIIIB/CD16b, Human (Biotinylated, NA2)

Fc gamma RIIIB/CD16b, Human (Biotinylated, NA2)

Size

SKU:QM-0189310-01

£282.06 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Fc gamma RIIIB/CD16b Protein, a low-affinity receptor for IgG, binds complexed or monomeric IgG. Unlike Fc gamma RIIIA, it cannot mediate antibody-dependent cytotoxicity or phagocytosis. Instead, Fc gamma RIIIB may act as a trap for immune complexes, circulating without activating neutrophils. Existing as a monomer, it interacts with INPP5D/SHIP1, implying its role in intracellular signaling pathways linked to immune responses. Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA2) is the recombinant human-derived Fc gamma RIIIB/CD16b protein, expressed by E. coli , with tag free.

  • Molecular Formula

    2215 (Gene_ID) O75015 (M18-G193) (Accession)

  • Smiles

    MRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQG

  • Purity

    95.7

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0189310-01
20 µgQM-0189310-01
£282.06/ea
£0.00
£282.06/ea £0.00
100 µgQM-0189310-02
100 µgQM-0189310-02
£702.46/ea
£0.00
£702.46/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Fc gamma RIIIB/CD16b, Human (Biotinylated, NA2)

Fc gamma RIIIB/CD16b, Human (Biotinylated, NA2) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.