Skip to product information
1 of 1

FCGRT, Human (GST)

FCGRT, Human (GST)

Size

SKU:QM-0199940-01

£93.63 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The FCGRT protein is a cell surface receptor that conveys passive humoral immunity through the selective uptake of monomeric IgG in milk. It binds IgG at the intestinal epithelium and forms an FcRn-IgG complex that is transcytosed across the epithelium, releasing IgG into the blood or tissue. FCGRT Protein, Human (GST) is the recombinant human-derived FCGRT protein, expressed by E. coli , with N-GST labeled tag.

  • Molecular Formula

    2217 (Gene_ID) P55899 (A24-S297) (Accession)

  • Smiles

    AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0199940-01
5 µgQM-0199940-01
£93.63/ea
£0.00
£93.63/ea £0.00
10 µgQM-0199940-02
10 µgQM-0199940-02
£142.00/ea
£0.00
£142.00/ea £0.00
50 µgQM-0199940-03
50 µgQM-0199940-03
£404.78/ea
£0.00
£404.78/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FCGRT, Human (GST)

FCGRT, Human (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.