Skip to product information
1 of 1

FCRL2, Human (HEK293, C-His)

FCRL2, Human (HEK293, C-His)

Size

SKU:QM-0169790-01

£67.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The FCRL2 protein regulates normal and neoplastic B cell development and has been shown to be involved in complex processes that control B cell maturation. Its tyrosine-phosphorylated isoform 2 interacts with PTPN6, suggesting the existence of a signaling pathway and emphasizing the role of this protein in cellular regulation. FCRL2 Protein, Human (HEK293, C-His) is the recombinant human-derived FCRL2, expressed by HEK293, with C-6*His labeled tag. The total length of FCRL2 Protein, Human (HEK293, C-His) is 376 a.a..

  • Molecular Formula

    79368 (Gene_ID) Q96LA5-1 (L20-D395) (Accession)

  • Smiles

    LTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQSAVLSDSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPVLTASSFQPIEGGPVSLKCETRLSPQRLDVQLQFCFFRENQVLGSGWSSSPELQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHVQRIPISNVSLEIRAPGGQVTEGQKLILLCSVAGGTGNVTFSWYREATGTSMGKKTQRSLSAELEIPAVKESDAGKYYCRADNGHVPIQSKVVNIPVRIPVSRPVLTLRSPGAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSGGGASFNLSLTAEHSGNYSCEANNGLGAQCSEAVPVSISGPDGYRRD

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0169790-01
5 µgQM-0169790-01
£67.44/ea
£0.00
£67.44/ea £0.00
10 µgQM-0169790-02
10 µgQM-0169790-02
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0169790-03
50 µgQM-0169790-03
£243.19/ea
£0.00
£243.19/ea £0.00
100 µgQM-0169790-04
100 µgQM-0169790-04
£359.82/ea
£0.00
£359.82/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FCRL2, Human (HEK293, C-His)

FCRL2, Human (HEK293, C-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.