Name: Fetuin A/AHSG, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0205575-01
Price: 61.22 GBP
Availability: InStock

Product Details

Description
Fetuin A (or AHSG protein) plays multiple roles in cellular processes, promotes endocytosis and displays opsonic properties. It regulates the mineral phase of bone, affects bone homeostasis, and has significant affinity for calcium and barium ions. Fetuin A/AHSG Protein, Human (HEK293, His) is the recombinant human-derived Fetuin A/AHSG protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
197 (Gene_ID) AAH48198.1/NP_001613.2 (A19-V367) (Accession)
Smiles
APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205575-01	5 µgQM-0205575-01 £61.22/ea	£0.00	Quantity	£61.22/ea	£0.00

10 µgQM-0205575-02	10 µgQM-0205575-02 £91.38/ea	£0.00	Quantity	£91.38/ea	£0.00

50 µgQM-0205575-03	50 µgQM-0205575-03 £249.26/ea	£0.00	Quantity	£249.26/ea	£0.00

100 µgQM-0205575-04	100 µgQM-0205575-04 £388.99/ea	£0.00	Quantity	£388.99/ea	£0.00

500 µgQM-0205575-05	500 µgQM-0205575-05 £1,377.99/ea	£0.00	Quantity	£1,377.99/ea	£0.00

1 mgQM-0205575-06	1 mgQM-0205575-06 £1,932.04/ea	£0.00	Quantity	£1,932.04/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Fetuin A/AHSG, Human (HEK293, His)

Fetuin A/AHSG, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.