Fetuin B, Mouse (HEK293, His)

Name: Fetuin B, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0194534-01
Price: 70.54 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0194534-01

£70.54 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Fetub Protein, a glycoprotein, plays a significant role in regulating insulin sensitivity and lipid metabolism. Dysregulation of Fetub Protein has been associated with several diseases, including obesity and type 2 diabetes. Fetuin B Protein, Mouse (HEK293, His) is the recombinant mouse-derived Fetuin B protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
59083 (Gene_ID) Q9QXC1 (R19-P388) (Accession)
Smiles
RSPPAPPLPQRPLSPLHPLGCNDSEVLAVAGFALQNINRDQKDGYMLSLNRVHDVREHYQEDMGSLFYLTLDVLETDCHVLSRKAQKDCKPRMFYESVYGQCKAMFHINKPRRVLYLPAYNCTLRPVSKRKTHTTCPDCPSPIDLSNPSALEAATESLAKFNSKSPSKKYELVKVTKAMNQWVSGPAYYVEYLIKEAPCTKSQASCSLQHSDSEPVGICQGSTVQSSLRHVPLIQPVEKSVTVTCEFFESQAQVPGDENPAVTQGPQKLPQKNTAPTSSPSVTAPRGSIQHLPELDDEKPEESKGGSPEEAFPVQLDLTTNPQGDTLDVSFLYLEPGDKKLVVLPFPGKEQRSAECPGPEKENNPLVLPP
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0194534-01	5 µgQM-0194534-01 £70.54/ea	£0.00	Quantity	£70.54/ea	£0.00

10 µgQM-0194534-02	10 µgQM-0194534-02 £109.38/ea	£0.00	Quantity	£109.38/ea	£0.00

50 µgQM-0194534-03	50 µgQM-0194534-03 £305.15/ea	£0.00	Quantity	£305.15/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Fetuin B, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.