FGF-1, Canine

Name: FGF-1, Canine
Brand: QuantiMol
SKU: QM-0202255-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 100 µg

SKU:QM-0202255-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The FGF-1 protein is critical in cellular regulation, coordinating key processes such as cell survival, division, angiogenesis, differentiation and migration. It exhibits potent mitogenic properties in vitro and serves as a ligand for FGFR1 and integrins. FGF-1 Protein, Canine is the recombinant canine-derived FGF-1 protein, expressed by E. coli , with tag free.
Molecular Formula
607724 (Gene_ID) J9NTP4 (F16-D155) (Accession)
Smiles
FNLPPGNYMKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Purity
90
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0202255-01	2 µgQM-0202255-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0202255-02	10 µgQM-0202255-02 £94.75/ea	£0.00	Quantity	£94.75/ea	£0.00

100 µgQM-0202255-03	100 µgQM-0202255-03 £249.26/ea	£0.00	Quantity	£249.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

FGF-1, Canine is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.