1 1

FGF-1, Human

FGF-1, Human

Size

QM-0077133-01

£58.12 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    FGF-1 Protein, Human is a growth factor and signaling protein encoded by the FGF1 gene.

  • Molecular Formula

    2246 (Gene_ID) P05230-1 (F16-D155) (Accession)

  • Smiles

    FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0077133-01
2 µgQM-0077133-01
£58.12/ea		 £0.00
£58.12/ea £0.00
10 µgQM-0077133-02
10 µgQM-0077133-02
£81.92/ea		 £0.00
£81.92/ea £0.00
50 µgQM-0077133-03
50 µgQM-0077133-03
£147.63/ea		 £0.00
£147.63/ea £0.00
100 µgQM-0077133-04
100 µgQM-0077133-04
£271.13/ea		 £0.00
£271.13/ea £0.00
250 µgQM-0077133-05
250 µgQM-0077133-05
£492.26/ea		 £0.00
£492.26/ea £0.00
500 µgQM-0077133-06
500 µgQM-0077133-06
£658.72/ea		 £0.00
£658.72/ea £0.00
1 mgQM-0077133-07
1 mgQM-0077133-07
£847.04/ea		 £0.00
£847.04/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

FGF-1, Human

FGF-1, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.