FGF-1, Human (154a.a)

Name: FGF-1, Human (154a.a)
Brand: QuantiMol
SKU: QM-0202473-01
Price: 81.92 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202473-01

£81.92 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
FGF-1 protein complexly regulates cell survival, division, angiogenesis, differentiation, and migration. As a potent mitogen, it acts as a ligand for FGFR1 and integrins. FGF-1 Protein, Human (154a.a) is the recombinant human-derived FGF-1 protein, expressed by E. coli , with tag free.
Molecular Formula
2246 (Gene_ID) P05230-1 (A2-D155) (Accession)
Smiles
AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202473-01	5 µgQM-0202473-01 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

10 µgQM-0202473-02	10 µgQM-0202473-02 £122.88/ea	£0.00	Quantity	£122.88/ea	£0.00

50 µgQM-0202473-03	50 µgQM-0202473-03 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

100 µgQM-0202473-04	100 µgQM-0202473-04 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

FGF-1, Human (154a.a) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.