1 1

FGF-1, Human (Biotinylated, His, Avi)

FGF-1, Human (Biotinylated, His, Avi)

Size

QM-0026195

Price on request

Request quote or documents

View full details

Product Details

  • Description

    FGF-1 protein complexly regulates cell survival, division, angiogenesis, differentiation, and migration. As a potent mitogen, it acts as a ligand for FGFR1 and integrins. FGF-1 Protein, Human (Biotinylated, His, Avi) is the recombinant human-derived FGF-1 protein, expressed by E. coli, with N-His and N-Avi labeled tag.

  • Molecular Formula

    2246 (Gene_ID) P05230-1 (F16-D155) (Accession)

  • Smiles

    FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
1 EachQM-0026195
1 EachQM-0026195
£0.00/ea		 £0.00
£0.00/ea £0.00

Related Products

Other industry favorites

FGF-1, Human (Biotinylated, His, Avi)

FGF-1, Human (Biotinylated, His, Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.