Name: FGF-1, Mouse (N-His)
Brand: QuantiMol
SKU: QM-0192975-01
Price: 58.12 GBP
Availability: InStock

Product Details

Description
The FGF-1 protein plays a key role in regulating a variety of cellular processes, serving as a potent mitogen and ligand for FGFR1 and integrins. In the presence of heparin, FGF-1 binds to FGFR1, initiating dimerization and autophosphorylation, resulting in multiple signaling cascades. FGF-1 Protein, Mouse (N-His) is the recombinant mouse-derived FGF-1 protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
14164 (Gene_ID) P61148 (F16-D155) (Accession)
Smiles
FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0192975-01	2 µgQM-0192975-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0192975-02	10 µgQM-0192975-02 £109.38/ea	£0.00	Quantity	£109.38/ea	£0.00

50 µgQM-0192975-03	50 µgQM-0192975-03 £227.39/ea	£0.00	Quantity	£227.39/ea	£0.00

100 µgQM-0192975-04	100 µgQM-0192975-04 £335.52/ea	£0.00	Quantity	£335.52/ea	£0.00

500 µgQM-0192975-05	500 µgQM-0192975-05 £1,046.30/ea	£0.00	Quantity	£1,046.30/ea	£0.00

1 mgQM-0192975-06	1 mgQM-0192975-06 £1,544.45/ea	£0.00	Quantity	£1,544.45/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

FGF-1, Mouse (N-His)

FGF-1, Mouse (N-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.