FGF-12, Human (177 a.a)

Name: FGF-12, Human (177 a.a)
Brand: QuantiMol
SKU: QM-0204039-01
Price: 59.16 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0204039-01

£59.16 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
FGF-12 Protein, Human (177 a.a) is a single polypeptide chain with a molecular mass of 20.4 kDa. FGF12 can play a role in tissues by translocating into cells through the plasma membrane.
Molecular Formula
2257 (Gene_ID) P61328-1 (E67-T243) (Accession)
Smiles
MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Purity
96.95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0204039-01	2 µgQM-0204039-01 £59.16/ea	£0.00	Quantity	£59.16/ea	£0.00

10 µgQM-0204039-02	10 µgQM-0204039-02 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0204039-03	50 µgQM-0204039-03 £359.82/ea	£0.00	Quantity	£359.82/ea	£0.00

100 µgQM-0204039-04	100 µgQM-0204039-04 £580.96/ea	£0.00	Quantity	£580.96/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

FGF-12, Human (177 a.a) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.