FGF-14, Canine

Name: FGF-14, Canine
Brand: QuantiMol
SKU: QM-0204494-01
Price: 61.22 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0204494-01

£61.22 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Fibroblast growth factor 14 is a bioactive protein found in the brain and pituitary gland that promotes fibroblast growth and is involved in embryonic development, angiogenesis, tissue repair and other processes. FGF-14 plays a neuroprotective role in in vitro Alzheimer's disease (AD) models by inhibiting MAPK signaling. FGF-14 Protein, Canine is the recombinant canine-derived FGF14 protein, expressed by E. coli , with tag free.
Molecular Formula
100050897 (Gene_ID) XP_003363267.1 (K64-T252) (Accession)
Smiles
KNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQVMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKAGVTPSKSTSASAIMNGGKPVNKSKTT
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0204494-01	2 µgQM-0204494-01 £61.22/ea	£0.00	Quantity	£61.22/ea	£0.00

10 µgQM-0204494-02	10 µgQM-0204494-02 £133.00/ea	£0.00	Quantity	£133.00/ea	£0.00

50 µgQM-0204494-03	50 µgQM-0204494-03 £370.76/ea	£0.00	Quantity	£370.76/ea	£0.00

100 µgQM-0204494-04	100 µgQM-0204494-04 £591.89/ea	£0.00	Quantity	£591.89/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

FGF-14, Canine is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.