Skip to product information
1 of 1

FGF-15, Mouse (His-SUMO)

FGF-15, Mouse (His-SUMO)

Size

SKU:QM-0203174-01

£76.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    FGF-15 Protein crucially suppresses bile acid biosynthesis by down-regulating CYP7A1 expression, contributing to intricate bile acid homeostasis control. Interacting with MALRD1 suggests potential involvement in molecular pathways beyond bile acid regulation. The molecular associations and regulatory functions underscore FGF-15's significance in maintaining physiological balance, particularly in bile acid metabolism. FGF-15 Protein, Mouse (His-SUMO) is the recombinant mouse-derived FGF-15 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

  • Molecular Formula

    14170 (Gene_ID) O35622 (R26-K218) (Accession)

  • Smiles

    RPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGPYVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLIRYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQKPSNFIPVFHRSFFETGDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203174-01
5 µgQM-0203174-01
£76.75/ea
£0.00
£76.75/ea £0.00
10 µgQM-0203174-02
10 µgQM-0203174-02
£117.25/ea
£0.00
£117.25/ea £0.00
50 µgQM-0203174-03
50 µgQM-0203174-03
£320.94/ea
£0.00
£320.94/ea £0.00
100 µgQM-0203174-04
100 µgQM-0203174-04
£515.35/ea
£0.00
£515.35/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FGF-15, Mouse (His-SUMO)

FGF-15, Mouse (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.