FGF-16, Human (CHO)

Name: FGF-16, Human (CHO)
Brand: QuantiMol
SKU: QM-0181394-01
Price: 97.0 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0181394-01

£97.00 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
FGF-16 Protein, Human (CHO) is a polypeptide chain containing 206 amino acids produced in CHO cells. FGF-16 is a heparin binding growth factor, a member of the FGF family.
Molecular Formula
8823 (Gene_ID) O43320 (A2-R207) (Accession)
Smiles
AEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Purity
97.1
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0181394-01	10 µgQM-0181394-01 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0181394-02	50 µgQM-0181394-02 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

FGF-16, Human (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.