FGF-17, Human

Name: FGF-17, Human
Brand: QuantiMol
SKU: QM-0189572-01
Price: 127.38 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0189572-01

£127.38 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
FGF-17 Protein plays a crucial role in embryonic development, serving as a signaling molecule for brain induction and patterning. Its presence is vital for normal brain development, emphasizing its significance in shaping embryogenesis intricacies. FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in signaling cascades that precisely orchestrate developmental events in the embryonic brain. FGF-17 Protein, Human is the recombinant human-derived FGF-17 protein, expressed by E. coli , with tag free.
Molecular Formula
8822 (Gene_ID) O60258 (T23-T216) (Accession)
Smiles
TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0189572-01	10 µgQM-0189572-01 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0189572-02	50 µgQM-0189572-02 £359.82/ea	£0.00	Quantity	£359.82/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

FGF-17, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.