FGF-17, Mouse (His)

Name: FGF-17, Mouse (His)
Brand: QuantiMol
SKU: QM-0204440-01
Price: 55.02 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0204440-01

£55.02 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The FGF-17 Protein is crucial in regulating embryonic development, functioning as a signaling molecule for inducing and patterning the embryonic brain. It plays an essential role in normal brain development and interacts specifically with FGFR3 and FGFR4 receptors, pivotal in this developmental process. FGF-17 Protein, Mouse (His) is the recombinant mouse-derived FGF-17, expressed by E. coli, with C-6*His labeled tag. The total length of FGF-17 Protein, Mouse (His) is 194 a.a..
Molecular Formula
14171 (Gene_ID) P63075 (T23-T216) (Accession)
Smiles
TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0204440-01	2 µgQM-0204440-01 £55.02/ea	£0.00	Quantity	£55.02/ea	£0.00

10 µgQM-0204440-02	10 µgQM-0204440-02 £117.25/ea	£0.00	Quantity	£117.25/ea	£0.00

50 µgQM-0204440-03	50 µgQM-0204440-03 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

100 µgQM-0204440-04	100 µgQM-0204440-04 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

FGF-17, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.