FGF-18, Rat

Name: FGF-18, Rat
Brand: QuantiMol
SKU: QM-0204236-01
Price: 65.37 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0204236-01

£65.37 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
FGF-18 Protein, Rat is a heparin-binding polypeptide growth factor, involved in cartilage growth, maturation and the development of functional cartilage and bone tissue.
Molecular Formula
29369 (Gene_ID) O88182 (E28-R199) (Accession)
Smiles
EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQTELQKPFKYTTVTKRSR
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0204236-01	2 µgQM-0204236-01 £65.37/ea	£0.00	Quantity	£65.37/ea	£0.00

10 µgQM-0204236-02	10 µgQM-0204236-02 £147.63/ea	£0.00	Quantity	£147.63/ea	£0.00

50 µgQM-0204236-03	50 µgQM-0204236-03 £404.78/ea	£0.00	Quantity	£404.78/ea	£0.00

100 µgQM-0204236-04	100 µgQM-0204236-04 £647.78/ea	£0.00	Quantity	£647.78/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

FGF-18, Rat is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.