FGF-19, Human

Name: FGF-19, Human
Brand: QuantiMol
SKU: QM-0203185-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0203185-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.
Molecular Formula
9965 (Gene_ID) O95750 (R23-K216) (Accession)
Smiles
RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Purity
95.88
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0203185-01	2 µgQM-0203185-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0203185-02	10 µgQM-0203185-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0203185-03	50 µgQM-0203185-03 £260.19/ea	£0.00	Quantity	£260.19/ea	£0.00

100 µgQM-0203185-04	100 µgQM-0203185-04 £409.64/ea	£0.00	Quantity	£409.64/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

FGF-19, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.