Skip to product information
1 of 1

FGF-2, Mouse (154a.a)

FGF-2, Mouse (154a.a)

Size

SKU:QM-0205165-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    FGF-2 protein is a member of the fibroblast growth factor family, involved in biological processes such as bone healing, cartilage repair, tumor development, and nerve regeneration. FGF-2 is also a mitogen that accelerates cell proliferation. It regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. FGF-2 protein, Mouse (154 a.a.), is a recombinant protein produced in E. coli (Escherichia coli), consisting of 154 amino acids (M1-S154), and is untagged[1][2][3][4][5][6][7][8][9].

  • Molecular Formula

    14173 (Gene_ID) P15655 (M1-S154) (Accession)

  • Smiles

    MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205165-01
2 µgQM-0205165-01
£52.94/ea
£0.00
£52.94/ea £0.00
10 µgQM-0205165-02
10 µgQM-0205165-02
£72.61/ea
£0.00
£72.61/ea £0.00
50 µgQM-0205165-03
50 µgQM-0205165-03
£147.63/ea
£0.00
£147.63/ea £0.00
100 µgQM-0205165-04
100 µgQM-0205165-04
£271.13/ea
£0.00
£271.13/ea £0.00
500 µgQM-0205165-05
500 µgQM-0205165-05
£604.04/ea
£0.00
£604.04/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FGF-2, Mouse (154a.a)

FGF-2, Mouse (154a.a) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.