Skip to product information
1 of 1

FGF-20, Mouse (His)

FGF-20, Mouse (His)

Size

SKU:QM-0026226

Price on request
Quantity

Request quote or documents

View full details
  • Description

    FGF-20 Protein, Mouse (His) is the recombinant mouse-derived FGF-20 protein, expressed by E. coli, with N-6*His tag.

  • Molecular Formula

    80857 (Gene_ID) Q9ESL9 (M1-T211) (Accession)

  • Smiles

    MAPLTEVGAFLGGLEGLSQQVGSHFLLPPAGERPPLLGERRGALERGARGGPGSVELAHLHGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0026226
1 EachQM-0026226
£0.00/ea
£0.00
£0.00/ea £0.00

FGF-20, Mouse (His)

FGF-20, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.