Skip to product information
1 of 1

FGF-21, Cynomolgus (HEK293, His)

FGF-21, Cynomolgus (HEK293, His)

Size

SKU:QM-0190975-01

£232.25 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    FGF-21 is a metabolic regulator and a potential anti-diabetic agent. FGF-21 regulates energy balance and glucose and lipid homeostasis through a heterodimeric receptor complex comprising FGFR1 and -klotho. FGF-21 can also signal through FGFR2 and FGFR3. FGF-21 can be used for research of obesity, NASH, NAFLD, and type 2 diabetes mellitus[1][2]. FGF-21 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived FGF-21 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    102126624 (Gene_ID) A0A2K5UYN8/XM_005589811.2 (H29-S209) (Accession)

  • Smiles

    HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAAHQSPESLLQLKALKPGVIQILGVKTSRFLCQKPDGALYGSLHFDPEACSFRELLLENGYNVYQSEAHGLPLHLPGNKSPHRDPASQGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQARSPSYAS

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0190975-01
10 µgQM-0190975-01
£232.25/ea
£0.00
£232.25/ea £0.00
50 µgQM-0190975-02
50 µgQM-0190975-02
£559.09/ea
£0.00
£559.09/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FGF-21, Cynomolgus (HEK293, His)

FGF-21, Cynomolgus (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.