FGF-21, Human

Name: FGF-21, Human
Brand: QuantiMol
SKU: QM-0192422-01
Price: 205.52 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0192422-01

£205.52 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
FGF-21 Protein, Human is an atypical member of the ﬁbroblast growth factor (FGF) subfamily, acts as a metabolic regulator with pleiotropic effects.
Molecular Formula
26291 (Gene_ID) Q9NSA1 (H29-S209, with an N-terminal Gly) (Accession)
Smiles
GHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0192422-01	10 µgQM-0192422-01 £205.52/ea	£0.00	Quantity	£205.52/ea	£0.00

50 µgQM-0192422-02	50 µgQM-0192422-02 £448.52/ea	£0.00	Quantity	£448.52/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

FGF-21, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.