1 1

FGF-21, Human (181a.a)

FGF-21, Human (181a.a)

Size

QM-0202982-01

£58.12 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    FGF-21 Protein, Human (181a.a), Human is an atypical member of the fibroblast growth factor (FGF) subfamily, acts as a metabolic regulator with pleiotropic effects.

  • Molecular Formula

    26291 (Gene_ID) Q9NSA1 (H29-S209) (Accession)

  • Smiles

    HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0202982-01
2 µgQM-0202982-01
£58.12/ea		 £0.00
£58.12/ea £0.00
10 µgQM-0202982-02
10 µgQM-0202982-02
£97.00/ea		 £0.00
£97.00/ea £0.00
50 µgQM-0202982-03
50 µgQM-0202982-03
£271.13/ea		 £0.00
£271.13/ea £0.00
100 µgQM-0202982-04
100 µgQM-0202982-04
£426.65/ea		 £0.00
£426.65/ea £0.00
250 µgQM-0202982-05
250 µgQM-0202982-05
£769.28/ea		 £0.00
£769.28/ea £0.00
500 µgQM-0202982-06
500 µgQM-0202982-06
£1,212.76/ea		 £0.00
£1,212.76/ea £0.00
1 mgQM-0202982-07
1 mgQM-0202982-07
£1,876.14/ea		 £0.00
£1,876.14/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

FGF-21, Human (181a.a)

FGF-21, Human (181a.a) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.