FGF-23, Human

Name: FGF-23, Human
Brand: QuantiMol
SKU: QM-0185825-01
Price: 205.52 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0185825-01

£205.52 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
FGF-23 Protein, Human is a unique FGF subfamily member, acts as a hormone and requires α-Klotho to signal through canonical FGFR, and induces hypertrophy and mineralization during chondrogenesis.
Molecular Formula
8074 (Gene_ID) Q9GZV9 (Y25-F251) (Accession)
Smiles
YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0185825-01	10 µgQM-0185825-01 £205.52/ea	£0.00	Quantity	£205.52/ea	£0.00

50 µgQM-0185825-02	50 µgQM-0185825-02 £537.21/ea	£0.00	Quantity	£537.21/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

FGF-23, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.