1 1

FGF-8c, Mouse

FGF-8c, Mouse

Size

QM-0001322

Price on request

Request quote or documents

View full details

Product Details

  • Description

    FGF-8c Protein, Mouse is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.

  • Molecular Formula

    14179 (Gene_ID) P37237 (Q23-R268) (Accession)

  • Smiles

    MQVRSAAQKRGPGAGNPADTLGQGHEDRPFGQRSRAGKNFTNPAPNYPEEGSKEQRDSVLPKVTQRHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
1 EachQM-0001322
1 EachQM-0001322
£0.00/ea		 £0.00
£0.00/ea £0.00

Related Products

Other industry favorites

FGF-8c, Mouse

FGF-8c, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.