FGF-8c, Mouse (His)

Name: FGF-8c, Mouse (His)
Brand: QuantiMol
SKU: QM-0202601-01
Price: 91.38 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0202601-01

£91.38 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
FGF-8c Protein, Mouse is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.
Molecular Formula
14179 (Gene_ID) P37237 (Q23-R268) (Accession)
Smiles
QVRSAAQKRGPGAGNPADTLGQGHEDRPFGQRSRAGKNFTNPAPNYPEEGSKEQRDSVLPKVTQRHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
Purity
96.8
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0202601-01	2 µgQM-0202601-01 £91.38/ea	£0.00	Quantity	£91.38/ea	£0.00

10 µgQM-0202601-02	10 µgQM-0202601-02 £251.69/ea	£0.00	Quantity	£251.69/ea	£0.00

50 µgQM-0202601-03	50 µgQM-0202601-03 £614.98/ea	£0.00	Quantity	£614.98/ea	£0.00

100 µgQM-0202601-04	100 µgQM-0202601-04 £1,009.85/ea	£0.00	Quantity	£1,009.85/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

FGF-8c, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.