FGF-8f, Human

Name: FGF-8f, Human
Brand: QuantiMol
SKU: QM-0171259-01
Price: 227.39 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0171259-01

£227.39 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
FGF-8f Protein, Human is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.
Molecular Formula
2253 (Gene_ID) P55075-4 (Q23-R244) (Accession)
Smiles
MQEGPGRGPALGRELASLFRAGREPQGVSQQVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0171259-01	10 µgQM-0171259-01 £227.39/ea	£0.00	Quantity	£227.39/ea	£0.00

50 µgQM-0171259-02	50 µgQM-0171259-02 £481.32/ea	£0.00	Quantity	£481.32/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

FGF-8f, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.