Skip to product information
1 of 1

FGF-8f, Human

FGF-8f, Human

Size

SKU:QM-0171259-01

£227.39 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    FGF-8f Protein, Human is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.

  • Molecular Formula

    2253 (Gene_ID) P55075-4 (Q23-R244) (Accession)

  • Smiles

    MQEGPGRGPALGRELASLFRAGREPQGVSQQVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0171259-01
10 µgQM-0171259-01
£227.39/ea
£0.00
£227.39/ea £0.00
50 µgQM-0171259-02
50 µgQM-0171259-02
£481.32/ea
£0.00
£481.32/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FGF-8f, Human

FGF-8f, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.