Skip to product information
1 of 1

FGF-9, Mouse (His, solution)

FGF-9, Mouse (His, solution)

Size

SKU:QM-0179263-01

£225.66 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    FGF-9 Protein, Mouse (His, solution) is a member of mouse fibroblast growth factors, Plays an important role in brain development and functions.

  • Molecular Formula

    14180 (Gene_ID) P54130 (M1-S208) (Accession)

  • Smiles

    MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0179263-01
10 µgQM-0179263-01
£225.66/ea
£0.00
£225.66/ea £0.00
50 µgQM-0179263-02
50 µgQM-0179263-02
£495.39/ea
£0.00
£495.39/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FGF-9, Mouse (His, solution)

FGF-9, Mouse (His, solution) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.