Skip to product information
1 of 1

FGF basic/bFGF, Bovine (P. pastoris, N-His)

FGF basic/bFGF, Bovine (P. pastoris, N-His)

Size

SKU:QM-0177009-01

£316.08 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    FGF2 protein is a multifunctional ligand that can bind to FGFR1, FGFR2, FGFR3 and FGFR4. It is also a key integrin ligand for FGF2 signal transduction and has an important interaction with the integrin ITGAV:ITGB3. FGF2 plays a critical role in cell survival, division, differentiation, and migration, serves as a potent mitogen, and induces angiogenesis. FGF basic/bFGF protein, Bovine (P. pastoris, N-His) is the recombinant bovine-derived FGF2 protein, expressed by P. pastoris , with N-6*His labeled tag.

  • Molecular Formula

    281161 (Gene_ID) P03969 (P10-S155) (Accession)

  • Smiles

    PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0177009-01
20 µgQM-0177009-01
£316.08/ea
£0.00
£316.08/ea £0.00
50 µgQM-0177009-02
50 µgQM-0177009-02
£548.15/ea
£0.00
£548.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FGF basic/bFGF, Bovine (P. pastoris, N-His)

FGF basic/bFGF, Bovine (P. pastoris, N-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.