Skip to product information
1 of 1

FGF basic/bFGF, Human (145a.a, His)

FGF basic/bFGF, Human (145a.a, His)

Size

SKU:QM-0203824-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].FGF basic/bFGF Protein, Human (145a.a, His), consists of 145 amino acids, produced by E.coli with tag free.

  • Molecular Formula

    2247 (Gene_ID) P09038-4 (A144-S288) (Accession)

  • Smiles

    ALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0203824-01
2 µgQM-0203824-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0203824-02
10 µgQM-0203824-02
£90.25/ea
£0.00
£90.25/ea £0.00
50 µgQM-0203824-03
50 µgQM-0203824-03
£249.26/ea
£0.00
£249.26/ea £0.00
100 µgQM-0203824-04
100 µgQM-0203824-04
£381.69/ea
£0.00
£381.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FGF basic/bFGF, Human (145a.a, His)

FGF basic/bFGF, Human (145a.a, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.