FGF basic/bFGF, Human (P. pastoris, N-His)

Name: FGF basic/bFGF, Human (P. pastoris, N-His)
Brand: QuantiMol
SKU: QM-0197107-01
Price: 147.63 GBP
Availability: InStock

Size 20 µg 50 µg 100 µg

SKU:QM-0197107-01

£147.63 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
FGF basic, or bFGF (fibroblast growth factor basic), initiates at an alternative CUG codon, marking a distinctive feature in translational initiation. This alternative start codon plays a pivotal role in regulating the expression and functional properties of FGF basic. FGF basic/bFGF Protein, Human (P. pastoris, N-His) is the recombinant human-derived FGF basic/bFGF protein, expressed by P. pastoris , with N-6*His labeled tag.
Molecular Formula
2247 (Gene_ID) P09038-4 (P143-S288) (Accession)
Smiles
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
20 µgQM-0197107-01	20 µgQM-0197107-01 £147.63/ea	£0.00	Quantity	£147.63/ea	£0.00

50 µgQM-0197107-02	50 µgQM-0197107-02 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

100 µgQM-0197107-03	100 µgQM-0197107-03 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

FGF basic/bFGF, Human (P. pastoris, N-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.