FGF basic, Salmon

Name: FGF basic, Salmon
Brand: QuantiMol
SKU: QM-0181573-01
Price: 88.0 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0181573-01

£88.00 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
FGF basic Protein, Salmon is the recombinant FGF-basic protein, expressed by E. coli, with tag free.
Molecular Formula
118363560 (Gene_ID) XP_035600424.1 (M1-R155) (Accession)
Smiles
MATGEITTLPATPEDGGSGGFPPGNFKEPKRLYCKNGGYFLRINSNGSVDGIREKNDPHIKLQLQATSVGEVVIKGVSANRYLAMNGDGRLFGTRRTTDECYFMERLESNNYNTYRSRKYPDMYVALKRTGQHKSGSKTGPGQKAILFLPMSARR
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0181573-01	10 µgQM-0181573-01 £88.00/ea	£0.00	Quantity	£88.00/ea	£0.00

50 µgQM-0181573-02	50 µgQM-0181573-02 £227.39/ea	£0.00	Quantity	£227.39/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

FGF basic, Salmon is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.