FGFR-1 alpha (IIIb), Human (HEK293, His)
FGFR-1 alpha (IIIb), Human (HEK293, His)
SKU:QM-0204382-01
Couldn't load pickup availability
Request quote or documents
Product Details
-
Description
FGFR-1 alpha, a conserved member of the FGFR family, binds acidic and basic fibroblast growth factors, influencing mitogenesis and differentiation. Mutations in FGFR1 cause syndromes and disorders. It exhibits ubiquitous expression, with notable levels in ovary (RPKM 21.8), fat (RPKM 21.4), and 25 other tissues. Alternatively spliced variants contribute to its functional diversity. FGFR-1 alpha (IIIb) Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived FGFR-1 alpha, expressed by HEK293 , with C-His, C-10*His labeled tag. FGFR-1 alpha (IIIb) Protein, Human (HEK293, His), has molecular weight of 60-90 kDa.
-
Molecular Formula
2260 (Gene_ID) P11362-7/NP_056934.2 (R22-K310&A359-E374) &AAB19502 (H1-P47) (Accession)
-
Smiles
A1:RPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKA2:ALEERPAVMTSPLYLEA3:HSGINSSDAEVLTLFNVTEAQSGEYVCKVSNYIGEANQSAWLTVTRP
-
Purity
95
-
Storage Conditions
Stored at -20°C for 2 years
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0048054-01 [1,4-BIs (diphenylphosphino) butane] (1,5-cyclooctadiene) rhodium (I) (tetrafluoroborate) [CAS 79255-71-3]
- QM-0047852-01 [1,4-Bis (diphenylphosphino) butane] (norbornadiene) rhodium (tetrafluoroborate) [CAS 82499-43-2]
- QM-0025230 β-catenin inhibitory peptoid [CAS 2579070-02-1]
- QM-0023369 α-Synuclein inhibitor 14 [CAS 408324-13-0]
- QM-0013035 α-Synuclein inhibitor 15 [CAS 414880-30-1]
- QM-0009265 α-syn aggregation inhibitor-1
- QM-0007272 Zavondemstat (sodium) [CAS 2908753-07-9]
- QM-0006348-01 Xanthoanthrafil-d3 [CAS 1216710-83-6]
- QM-0006347-01 Xanthoanthrafil [CAS 1020251-53-9]
- QM-0002491-01 Ziritaxestat (Standard) [CAS 1628260-79-6]
Other industry favorites
- QM-0048054-01 [1,4-BIs (diphenylphosphino) butane] (1,5-cyclooctadiene) rhodium (I) (tetrafluoroborate) [CAS 79255-71-3]
- QM-0047852-01 [1,4-Bis (diphenylphosphino) butane] (norbornadiene) rhodium (tetrafluoroborate) [CAS 82499-43-2]
- QM-0153508-01 α-Synuclein inhibitor 11
- QM-0156055-01 YAP/TAZ inhibitor-3 [CAS 2506273-81-8]
- QM-0126644 [Leu8, D-Trp22, Tyr25] Somatostatin-28 [CAS 77909-99-0]
- QM-0126181 YAP/TAZ inhibitor-4
- QM-0112034-01 Zamicastat [CAS 1080028-80-3]
- QM-0152031-01 WRN inhibitor 5 [CAS 2923009-95-2]
- QM-0167342 [Lys4] Sarafotoxin S6c [CAS 1219444-22-0]
- QM-0166278 [Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) [CAS 141055-85-8]
FGFR-1 alpha (IIIb), Human (HEK293, His)
FGFR-1 alpha (IIIb), Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.